Lineage for d4xfja1 (4xfj A:2-172)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842519Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1842520Protein automated matches [190116] (18 species)
    not a true protein
  7. 1842573Species Mycobacterium thermoresistibile [TaxId:1078020] [260068] (2 PDB entries)
  8. 1842574Domain d4xfja1: 4xfj A:2-172 [269189]
    Other proteins in same PDB: d4xfja2, d4xfjb2
    automated match to d4u7ja1
    complexed with anp, arg, edo, mg

Details for d4xfja1

PDB Entry: 4xfj (more details), 1.55 Å

PDB Description: crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d4xfja1:

Sequence, based on SEQRES records: (download)

>d4xfja1 c.26.2.0 (A:2-172) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
servilaysggldtsvaiswigketgrevvavaidlgqggedmevvrqraldcgavesiv
idardefandycvpaiqsnalymdryplvsalsrplivkhlvkaarehggtivahgctgk
gndqvrfevgfaslapdlevlapvrdyawtrekaiafaeennipinvtkrs

Sequence, based on observed residues (ATOM records): (download)

>d4xfja1 c.26.2.0 (A:2-172) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
servilaysggldtsvaiswigketgrevvavaidlgqggedmevvrqraldcgavesiv
idardefandycvpaiqsnalymdryplvsalsrplivkhlvkaarehggtivahgctgk
gndqvrfevgfaslapdlevlapvrdyawtrekaiafaeennipinvts

SCOPe Domain Coordinates for d4xfja1:

Click to download the PDB-style file with coordinates for d4xfja1.
(The format of our PDB-style files is described here.)

Timeline for d4xfja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xfja2