Lineage for d4xdib_ (4xdi B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689444Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [269183] (4 PDB entries)
  8. 2689450Domain d4xdib_: 4xdi B: [269187]
    automated match to d3aq5a_
    complexed with hem

Details for d4xdib_

PDB Entry: 4xdi (more details), 1.89 Å

PDB Description: structure of chlamydomonas reinhardtii thb1
PDB Compounds: (B:) Chlamydomonas reinhardtii THB1

SCOPe Domain Sequences for d4xdib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdib_ a.1.1.0 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
apadslysrmggeaavekavdvfyerivadpqlapffanvdmkkqrrkqvafmtyvfggs
gayegrdlgashrrlireqgmnhhhfdlvaahldstlqelgvaqelkaeamaivasarpl
ifg

SCOPe Domain Coordinates for d4xdib_:

Click to download the PDB-style file with coordinates for d4xdib_.
(The format of our PDB-style files is described here.)

Timeline for d4xdib_: