![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
![]() | Protein automated matches [190590] (26 species) not a true protein |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [269183] (4 PDB entries) |
![]() | Domain d4xdib_: 4xdi B: [269187] automated match to d3aq5a_ complexed with hem |
PDB Entry: 4xdi (more details), 1.89 Å
SCOPe Domain Sequences for d4xdib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xdib_ a.1.1.0 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} apadslysrmggeaavekavdvfyerivadpqlapffanvdmkkqrrkqvafmtyvfggs gayegrdlgashrrlireqgmnhhhfdlvaahldstlqelgvaqelkaeamaivasarpl ifg
Timeline for d4xdib_: