SCOPe 2.07: Domain d4xdia_: 4xdi A:

Lineage for d4xdia_ (4xdi A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (21 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [269183] (3 PDB entries)

8. Domain d4xdia_: 4xdi A: [269184]
   automated match to d3aq5a_
   complexed with hem

Details for d4xdia_

PDB Entry: 4xdi, 1.89 Å

PDB Description: structure of chlamydomonas reinhardtii thb1

PDB Compounds: (A:) Chlamydomonas reinhardtii THB1

SCOPe Domain Sequences for d4xdia_:

Sequence; same for both SEQRES and ATOM records:

>d4xdia_ a.1.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tapadslysrmggeaavekavdvfyerivadpqlapffanvdmkkqrrkqvafmtyvfgg
sgayegrdlgashrrlireqgmnhhhfdlvaahldstlqelgvaqelkaeamaivasarp
lifgtge

Timeline for d4xdia_:

• d4xdia_ first appeared in SCOPe 2.05
  
• d4xdia_ appears in SCOPe 2.06