SCOPe 2.07: Domain d1fdia1: 1fdi A:565-715

Lineage for d1fdia1 (1fdi A:565-715)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Formate dehydrogenase H [50700] (1 species)

7. Species Escherichia coli [TaxId:562] [50701] (4 PDB entries)

8. Domain d1fdia1: 1fdi A:565-715 [26918]
   Other proteins in same PDB: d1fdia2
   complexed with 6mo, mgd, no2, sf4

Details for d1fdia1

PDB Entry: 1fdi, 2.9 Å

PDB Description: oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite

PDB Compounds: (A:) formate dehydrogenase h

SCOPe Domain Sequences for d1fdia1:

Sequence; same for both SEQRES and ATOM records:

>d1fdia1 b.52.2.2 (A:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

Timeline for d1fdia1:

• d1fdia1 first appeared (with stable ids) in SCOP 1.55, called d1fdi_1
  
• d1fdia1 appears in SCOPe 2.06
  
• d1fdia1 appears in the current release, SCOPe 2.08