SCOP 1.57: Domain d1fdi_1: 1fdi 565-715

Lineage for d1fdi_1 (1fdi 565-715)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins)

6. Protein Formate dehydrogenase H [50700] (1 species)

7. Species Escherichia coli [TaxId:562] [50701] (3 PDB entries)

8. Domain d1fdi_1: 1fdi 565-715 [26918]
   Other proteins in same PDB: d1fdi_2

Details for d1fdi_1

PDB Entry: 1fdi, 2.9 Å

PDB Description: oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite

SCOP Domain Sequences for d1fdi_1:

Sequence; same for both SEQRES and ATOM records:

>d1fdi_1 b.52.2.2 (565-715) Formate dehydrogenase H {Escherichia coli}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

Timeline for d1fdi_1:

• d1fdi_1 first appeared (with stable ids) in SCOP 1.55
  
• d1fdi_1 appears in SCOP 1.59
  
• d1fdi_1 appears in the current release, SCOPe 2.08, called d1fdia1