Lineage for d1fdi_1 (1fdi 565-715)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61730Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 61744Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 61750Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins)
  6. 61778Protein Formate dehydrogenase H [50700] (1 species)
  7. 61779Species Escherichia coli [TaxId:562] [50701] (3 PDB entries)
  8. 61782Domain d1fdi_1: 1fdi 565-715 [26918]
    Other proteins in same PDB: d1fdi_2

Details for d1fdi_1

PDB Entry: 1fdi (more details), 2.9 Å

PDB Description: oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite

SCOP Domain Sequences for d1fdi_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdi_1 b.52.2.2 (565-715) Formate dehydrogenase H {Escherichia coli}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

SCOP Domain Coordinates for d1fdi_1:

Click to download the PDB-style file with coordinates for d1fdi_1.
(The format of our PDB-style files is described here.)

Timeline for d1fdi_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fdi_2