Lineage for d1fdi_1 (1fdi 565-715)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) Superfamily b.52.2: ADC-like [50692] (3 families) 
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins) 
Protein Formate dehydrogenase H [50700] (1 species) Species Escherichia coli [TaxId:562] [50701] (3 PDB entries) 
Domain d1fdi_1: 1fdi 565-715 [26918]
Other proteins in same PDB: d1fdi_2
Details for d1fdi_1
PDB Entry: 1fdi (more details), 2.9 Å
PDB Description: oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite
SCOP Domain Sequences for d1fdi_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdi_1 b.52.2.2 (565-715) Formate dehydrogenase H {Escherichia coli}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala
SCOP Domain Coordinates for d1fdi_1:
Click to download the PDB-style file with coordinates for d1fdi_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fdi_1:
- d1fdi_1 appears in SCOP 1.57
- d1fdi_1 appears in the current release, SCOPe 2.08, called d1fdia1
View in 3D
