Class b: All beta proteins [48724] (180 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
Protein Formate dehydrogenase H [50700] (1 species) |
Species Escherichia coli [TaxId:562] [50701] (4 PDB entries) |
Domain d1fdia1: 1fdi A:565-715 [26918] Other proteins in same PDB: d1fdia2 complexed with 6mo, mgd, no2, sf4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1fdi (more details), 2.9 Å
SCOPe Domain Sequences for d1fdia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdia1 b.52.2.2 (A:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr vepiadqraaeqyvideynklktrlreaala
Timeline for d1fdia1: