Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Actinomadura melliaura [TaxId:360723] [269170] (2 PDB entries) |
Domain d4xaug1: 4xau G:1-369 [269174] Other proteins in same PDB: d4xaua2, d4xaub2, d4xauc2, d4xaud2, d4xaue2, d4xauf2, d4xaug2 automated match to d1mdza_ complexed with plp |
PDB Entry: 4xau (more details), 3 Å
SCOPe Domain Sequences for d4xaug1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xaug1 c.67.1.0 (G:1-369) automated matches {Actinomadura melliaura [TaxId: 360723]} miplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsglcl alrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkispat raiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgnmcv fsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwhmtd lnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkvddr pafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqdreh vvatirsgw
Timeline for d4xaug1: