Lineage for d1fdo_1 (1fdo 565-715)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 467166Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 467190Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 467217Protein Formate dehydrogenase H [50700] (1 species)
  7. 467218Species Escherichia coli [TaxId:562] [50701] (3 PDB entries)
  8. 467220Domain d1fdo_1: 1fdo 565-715 [26917]
    Other proteins in same PDB: d1fdo_2

Details for d1fdo_1

PDB Entry: 1fdo (more details), 2.8 Å

PDB Description: oxidized form of formate dehydrogenase h from e. coli

SCOP Domain Sequences for d1fdo_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdo_1 b.52.2.2 (565-715) Formate dehydrogenase H {Escherichia coli}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

SCOP Domain Coordinates for d1fdo_1:

Click to download the PDB-style file with coordinates for d1fdo_1.
(The format of our PDB-style files is described here.)

Timeline for d1fdo_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fdo_2