Lineage for d1fdoa1 (1fdo A:565-715)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802680Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2802707Protein Formate dehydrogenase H [50700] (1 species)
  7. 2802708Species Escherichia coli [TaxId:562] [50701] (4 PDB entries)
  8. 2802711Domain d1fdoa1: 1fdo A:565-715 [26917]
    Other proteins in same PDB: d1fdoa2
    complexed with 6mo, mgd, sf4
    has additional insertions and/or extensions that are not grouped together

Details for d1fdoa1

PDB Entry: 1fdo (more details), 2.8 Å

PDB Description: oxidized form of formate dehydrogenase h from e. coli
PDB Compounds: (A:) formate dehydrogenase h

SCOPe Domain Sequences for d1fdoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdoa1 b.52.2.2 (A:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

SCOPe Domain Coordinates for d1fdoa1:

Click to download the PDB-style file with coordinates for d1fdoa1.
(The format of our PDB-style files is described here.)

Timeline for d1fdoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fdoa2