Lineage for d1aa6_1 (1aa6 565-715)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563620Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 563643Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 563667Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 563694Protein Formate dehydrogenase H [50700] (1 species)
  7. 563695Species Escherichia coli [TaxId:562] [50701] (3 PDB entries)
  8. 563696Domain d1aa6_1: 1aa6 565-715 [26916]
    Other proteins in same PDB: d1aa6_2
    complexed with 4mo, cse, fs4, mgd

Details for d1aa6_1

PDB Entry: 1aa6 (more details), 2.3 Å

PDB Description: reduced form of formate dehydrogenase h from e. coli

SCOP Domain Sequences for d1aa6_1:

Sequence, based on SEQRES records: (download)

>d1aa6_1 b.52.2.2 (565-715) Formate dehydrogenase H {Escherichia coli}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

Sequence, based on observed residues (ATOM records): (download)

>d1aa6_1 b.52.2.2 (565-715) Formate dehydrogenase H {Escherichia coli}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwpeykycavrvepiadqraaeqyvidey
nklktrlreaala

SCOP Domain Coordinates for d1aa6_1:

Click to download the PDB-style file with coordinates for d1aa6_1.
(The format of our PDB-style files is described here.)

Timeline for d1aa6_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aa6_2