Lineage for d1aa6a1 (1aa6 A:565-715)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061195Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2061226Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 protein domains)
    molybdopterine enzyme
  6. 2061253Protein Formate dehydrogenase H [50700] (1 species)
  7. 2061254Species Escherichia coli [TaxId:562] [50701] (4 PDB entries)
  8. 2061256Domain d1aa6a1: 1aa6 A:565-715 [26916]
    Other proteins in same PDB: d1aa6a2
    complexed with 4mo, mgd, sf4

Details for d1aa6a1

PDB Entry: 1aa6 (more details), 2.3 Å

PDB Description: reduced form of formate dehydrogenase h from e. coli
PDB Compounds: (A:) formate dehydrogenase h

SCOPe Domain Sequences for d1aa6a1:

Sequence, based on SEQRES records: (download)

>d1aa6a1 b.52.2.2 (A:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

Sequence, based on observed residues (ATOM records): (download)

>d1aa6a1 b.52.2.2 (A:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwpeykycavrvepiadqraaeqyvidey
nklktrlreaala

SCOPe Domain Coordinates for d1aa6a1:

Click to download the PDB-style file with coordinates for d1aa6a1.
(The format of our PDB-style files is described here.)

Timeline for d1aa6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aa6a2