Class a: All alpha proteins [46456] (286 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
Protein automated matches [190141] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189956] (2 PDB entries) |
Domain d4x51b_: 4x51 B: [269151] automated match to d2ilka_ mutant |
PDB Entry: 4x51 (more details), 2.05 Å
SCOPe Domain Sequences for d4x51b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x51b_ a.26.1.3 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gqshmllelrtafsqvktffqtkdqldnilltdslmqdfkgylgcqalsemiqfylvevm pqaekhgpeikehlnslgeklktlrmrlrrchrflpcenkskaveqvksdfnklqdqgvy kamnefdifinyieaymmikm
Timeline for d4x51b_: