SCOPe 2.05: Domain d4x51b_: 4x51 B:

Lineage for d4x51b_ (4x51 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein automated matches [190141] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189956] (2 PDB entries)

8. Domain d4x51b_: 4x51 B: [269151]
   automated match to d2ilka_
   mutant

Details for d4x51b_

PDB Entry: 4x51, 2.05 Å

PDB Description: X-ray structure of mouse interleukin-10 mutant - S1_E8del, C149Y

PDB Compounds: (B:) interleukin-10

SCOPe Domain Sequences for d4x51b_:

Sequence; same for both SEQRES and ATOM records:

>d4x51b_ a.26.1.3 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gqshmllelrtafsqvktffqtkdqldnilltdslmqdfkgylgcqalsemiqfylvevm
pqaekhgpeikehlnslgeklktlrmrlrrchrflpcenkskaveqvksdfnklqdqgvy
kamnefdifinyieaymmikm

Timeline for d4x51b_:

• d4x51b_ is new in SCOPe 2.05-stable
  
• d4x51b_ appears in SCOPe 2.06
  
• d4x51b_ appears in the current release, SCOPe 2.08