Lineage for d2dmr_1 (2dmr 626-781)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 467166Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 467190Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 467199Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)
  7. 467200Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries)
  8. 467214Domain d2dmr_1: 2dmr 626-781 [26915]
    Other proteins in same PDB: d2dmr_2

Details for d2dmr_1

PDB Entry: 2dmr (more details), 2.8 Å

PDB Description: dithionite reduced dmso reductase from rhodobacter capsulatus

SCOP Domain Sequences for d2dmr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmr_1 b.52.2.2 (626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd
vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt
sklaqgncgqtvlaevekytgpavtltgfvapkaae

SCOP Domain Coordinates for d2dmr_1:

Click to download the PDB-style file with coordinates for d2dmr_1.
(The format of our PDB-style files is described here.)

Timeline for d2dmr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dmr_2