Lineage for d4x2ra1 (4x2r A:1-247)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079054Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 protein domains)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2079090Protein automated matches [190186] (10 species)
    not a true protein
  7. 2079091Species Actinomyces urogenitalis [TaxId:525246] [269148] (1 PDB entry)
  8. 2079092Domain d4x2ra1: 4x2r A:1-247 [269149]
    Other proteins in same PDB: d4x2ra2
    automated match to d4wd0a_
    complexed with cxs, po4

Details for d4x2ra1

PDB Entry: 4x2r (more details), 1.05 Å

PDB Description: crystal structure of pria from actinomyces urogenitalis
PDB Compounds: (A:) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase

SCOPe Domain Sequences for d4x2ra1:

Sequence, based on SEQRES records: (download)

>d4x2ra1 c.1.2.1 (A:1-247) automated matches {Actinomyces urogenitalis [TaxId: 525246]}
mltllpavdvadgkavrllqgeagsetdygspieaardwveagaewihlvdldaafgrgs
napllerivgevgikvelsggirddasltralkagaarvnlgtaaledpqwtarviaehg
ekiavgldvrgttlaargwtkeggdlwqtldrlneagcrryvvtdvtkdgtltgpntell
rqvaartsapvvasggisslediaalarlvpqgvdsaivgkalyngnftlpqalavagga
avqdvqa

Sequence, based on observed residues (ATOM records): (download)

>d4x2ra1 c.1.2.1 (A:1-247) automated matches {Actinomyces urogenitalis [TaxId: 525246]}
mltllpavdvadgkavrllqgeagsetdygspieaardwveagaewihlvdldaafgrgs
napllerivgevgikvelsggirddasltralkagaarvnlgtaaledpqwtarviaehg
ekiavgldvrgttlaarggdlwqtldrlneagcrryvvtdvtkdgtltgpntellrqvaa
rtsapvvasggisslediaalarlvpqgvdsaivgkalyngnftlpqalavaggaavqdv
qa

SCOPe Domain Coordinates for d4x2ra1:

Click to download the PDB-style file with coordinates for d4x2ra1.
(The format of our PDB-style files is described here.)

Timeline for d4x2ra1:

  • d4x2ra1 first appeared in SCOPe 2.05, called d4x2ra_

View in 3D
Domains from same chain:
(mouse over for more information)
d4x2ra2