Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (38 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225691] (16 PDB entries) |
Domain d4x0tb_: 4x0t B: [269144] automated match to d2jg7a_ complexed with 3w9, nad |
PDB Entry: 4x0t (more details), 2.4 Å
SCOPe Domain Sequences for d4x0tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x0tb_ c.82.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs dawkqymrrstctinyskdlplaqgikfq
Timeline for d4x0tb_: