SCOP 1.71: Domain d3dmr_1: 3dmr 626-781

Lineage for d3dmr_1 (3dmr 626-781)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
   molybdopterine enzyme

6. Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries)

8. Domain d3dmr_1: 3dmr 626-781 [26914]
   Other proteins in same PDB: d3dmr_2
   complexed with 6mo, o, pgd

Details for d3dmr_1

PDB Entry: 3dmr, 2.5 Å

PDB Description: structure of dmso reductase from rhodobacter capsulatus at ph 7.0

SCOP Domain Sequences for d3dmr_1:

Sequence; same for both SEQRES and ATOM records:

>d3dmr_1 b.52.2.2 (626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd
vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt
sklaqgncgqtvlaevekytgpavtltgfvapkaae

Timeline for d3dmr_1:

• d3dmr_1 first appeared (with stable ids) in SCOP 1.55
  
• d3dmr_1 appears in SCOP 1.69
  
• d3dmr_1 is called d3dmra1 in SCOP 1.73
  
• d3dmr_1 appears in the current release, SCOPe 2.08, called d3dmra1