Lineage for d4x0ea1 (4x0e A:9-199)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (52 species)
    not a true protein
  7. 2443350Species Mycobacterium tuberculosis [TaxId:83332] [269137] (4 PDB entries)
  8. 2443359Domain d4x0ea1: 4x0e A:9-199 [269139]
    Other proteins in same PDB: d4x0ea2, d4x0eb2
    automated match to d1yuma_
    complexed with mes, so4

Details for d4x0ea1

PDB Entry: 4x0e (more details), 2.41 Å

PDB Description: structure of m. tuberculosis nicotinate mono nucleotide adenylyltransferase
PDB Compounds: (A:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d4x0ea1:

Sequence, based on SEQRES records: (download)

>d4x0ea1 c.26.1.0 (A:9-199) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtviatasn
prfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweelfelar
fvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwylmpdg
vvqyvskcrly

Sequence, based on observed residues (ATOM records): (download)

>d4x0ea1 c.26.1.0 (A:9-199) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkqvsaaehrylmtviatasnpr
fsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweelfelarfv
gvsrpgyelrnehitsllgqlkdaltlveipalaisstdcrqraeqsrplwylmpdgvvq
yvskcrly

SCOPe Domain Coordinates for d4x0ea1:

Click to download the PDB-style file with coordinates for d4x0ea1.
(The format of our PDB-style files is described here.)

Timeline for d4x0ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4x0ea2