SCOPe 2.08: Domain d4x0eb1: 4x0e B:9-199

Lineage for d4x0eb1 (4x0e B:9-199)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [269137] (14 PDB entries)

8. Domain d4x0eb1: 4x0e B:9-199 [269138]
   Other proteins in same PDB: d4x0ea2, d4x0eb2
   automated match to d1yuma_
   complexed with mes, so4

Details for d4x0eb1

PDB Entry: 4x0e, 2.41 Å

PDB Description: structure of m. tuberculosis nicotinate mono nucleotide adenylyltransferase

PDB Compounds: (B:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d4x0eb1:

Sequence, based on SEQRES records:

>d4x0eb1 c.26.1.0 (B:9-199) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtviatasn
prfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweelfelar
fvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwylmpdg
vvqyvskcrly

Sequence, based on observed residues (ATOM records):

>d4x0eb1 c.26.1.0 (B:9-199) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtviatasn
prfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweelfelar
fvgvsrpgaltlveipalaisstdcrqraeqsrplwylmpdgvvqyvskcrly

Timeline for d4x0eb1:

• d4x0eb1 first appeared in SCOPe 2.05, called d4x0eb_
  
• d4x0eb1 appears in SCOPe 2.07