Lineage for d4wzah_ (4wza H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869314Protein automated matches [190304] (16 species)
    not a true protein
  7. 2869324Species Azotobacter vinelandii [TaxId:354] [269127] (1 PDB entry)
  8. 2869328Domain d4wzah_: 4wza H: [269135]
    Other proteins in same PDB: d4wzaa_, d4wzab_, d4wzac_, d4wzad_
    automated match to d1fp6c_
    complexed with acp, adp, clf, fe, hca, ics, mg, sf4

Details for d4wzah_

PDB Entry: 4wza (more details), 1.9 Å

PDB Description: asymmetric nucleotide binding in the nitrogenase complex
PDB Compounds: (H:) nitrogenase iron protein 1

SCOPe Domain Sequences for d4wzah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wzah_ c.37.1.10 (H:) automated matches {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmef

SCOPe Domain Coordinates for d4wzah_:

Click to download the PDB-style file with coordinates for d4wzah_.
(The format of our PDB-style files is described here.)

Timeline for d4wzah_: