Lineage for d4wzac_ (4wza C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878032Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1878139Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1878197Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 1878308Protein automated matches [190199] (2 species)
    not a true protein
  7. 1878309Species Azotobacter vinelandii [TaxId:354] [186943] (13 PDB entries)
  8. 1878321Domain d4wzac_: 4wza C: [269134]
    Other proteins in same PDB: d4wzab_, d4wzad_, d4wzae_, d4wzaf_, d4wzag_, d4wzah_
    automated match to d4tkua_
    complexed with acp, adp, clf, fe, hca, ics, mg, sf4

Details for d4wzac_

PDB Entry: 4wza (more details), 1.9 Å

PDB Description: asymmetric nucleotide binding in the nitrogenase complex
PDB Compounds: (C:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d4wzac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wzac_ c.92.2.3 (C:) automated matches {Azotobacter vinelandii [TaxId: 354]}
msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
gikekfifqkmgipfrqmhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOPe Domain Coordinates for d4wzac_:

Click to download the PDB-style file with coordinates for d4wzac_.
(The format of our PDB-style files is described here.)

Timeline for d4wzac_: