| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein automated matches [190304] (16 species) not a true protein |
| Species Azotobacter vinelandii [TaxId:354] [269127] (1 PDB entry) |
| Domain d4wzae_: 4wza E: [269133] Other proteins in same PDB: d4wzaa_, d4wzab_, d4wzac_, d4wzad_ automated match to d1fp6c_ complexed with acp, adp, clf, fe, hca, ics, mg, sf4 |
PDB Entry: 4wza (more details), 1.9 Å
SCOPe Domain Sequences for d4wzae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wzae_ c.37.1.10 (E:) automated matches {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimev
Timeline for d4wzae_: