SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4wz3a1 (4wz3 A:1-147)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164143Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2164279Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (18 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 2164299Domain d4wz3a1: 4wz3 A:1-147 [269130]
    Other proteins in same PDB: d4wz3a2
    automated match to d4ldtc_

Details for d4wz3a1

PDB Entry: 4wz3 (more details), 2.7 Å

PDB Description: crystal structure of the complex between lubx/legu2/lpp2887 u-box 1 and homo sapiens ube2d2
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4wz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wz3a1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d4wz3a1:

Click to download the PDB-style file with coordinates for d4wz3a1.
(The format of our PDB-style files is described here.)

Timeline for d4wz3a1:

  • d4wz3a1 first appeared in SCOPe 2.05, called d4wz3a_