Lineage for d4wz3a1 (4wz3 A:1-147)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164143Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2164279Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (18 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 2164299Domain d4wz3a1: 4wz3 A:1-147 [269130]
    Other proteins in same PDB: d4wz3a2
    automated match to d4ldtc_

Details for d4wz3a1

PDB Entry: 4wz3 (more details), 2.7 Å

PDB Description: crystal structure of the complex between lubx/legu2/lpp2887 u-box 1 and homo sapiens ube2d2
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4wz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wz3a1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d4wz3a1:

Click to download the PDB-style file with coordinates for d4wz3a1.
(The format of our PDB-style files is described here.)

Timeline for d4wz3a1:

  • d4wz3a1 first appeared in SCOPe 2.05, called d4wz3a_