Lineage for d1e5vc1 (1e5v C:626-781)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412166Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2412197Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2412206Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)
  7. 2412207Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries)
  8. 2412219Domain d1e5vc1: 1e5v C:626-781 [26913]
    Other proteins in same PDB: d1e5va2, d1e5vc2
    complexed with 2mo, pgd, so4

Details for d1e5vc1

PDB Entry: 1e5v (more details), 2.4 Å

PDB Description: oxidized dmso reductase exposed to hepes buffer
PDB Compounds: (C:) dmso reductase

SCOPe Domain Sequences for d1e5vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5vc1 b.52.2.2 (C:626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]}
erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd
vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt
sklaqgncgqtvlaevekytgpavtltgfvapkaae

SCOPe Domain Coordinates for d1e5vc1:

Click to download the PDB-style file with coordinates for d1e5vc1.
(The format of our PDB-style files is described here.)

Timeline for d1e5vc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5vc2