Lineage for d4wy0b_ (4wy0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079861Species Geobacillus kaustophilus [TaxId:235909] [269096] (3 PDB entries)
  8. 2079863Domain d4wy0b_: 4wy0 B: [269121]
    automated match to d3fema_
    complexed with cac, edo, po4, r5p

Details for d4wy0b_

PDB Entry: 4wy0 (more details), 2.3 Å

PDB Description: pdxs (g. stearothermophilus) co-crystallized with r5p in the presence of ammonia.
PDB Compounds: (B:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d4wy0b_:

Sequence, based on SEQRES records: (download)

>d4wy0b_ c.1.2.0 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
tdrvkrgmaemqkggvimdvvnaeqakiaeaagavavmalervpadiraaggvarmadpt
vieevmnavsipvmakvrighyvearvlealgvdyidesevltpadeefhidkrqftvpf
vcgcrdlgeaarriaegasmlrtkgepgtgniveavrhmrkvnaqirkvvnmsedelvae
akqlgapvevlreikrlgrlpvvnfaaggvttpadaalmmhlgadgvfvgsgifksenpe
kyaraiveatthyedyeliahlskglg

Sequence, based on observed residues (ATOM records): (download)

>d4wy0b_ c.1.2.0 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
tdrvkrgmaemqkggvimdvvnaeqakiaeaagavavmaleraggvarmadptvieevmn
avsipvmakvrighyvearvlealgvdyidesevltpadeefhidkrqftvpfvcgcrdl
geaarriaegasmlrtkgepgtgniveavrhmrkvnaqirkvvnmsedelvaeakqlgap
vevlreikrlgrlpvvnfaaggvttpadaalmmhlgadgvfvgsgifksenpekyaraiv
eatthyedyeliahlskglg

SCOPe Domain Coordinates for d4wy0b_:

Click to download the PDB-style file with coordinates for d4wy0b_.
(The format of our PDB-style files is described here.)

Timeline for d4wy0b_: