SCOPe 2.06: Domain d1e60c1: 1e60 C:626-781

Lineage for d1e60c1 (1e60 C:626-781)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries)

8. Domain d1e60c1: 1e60 C:626-781 [26911]
   Other proteins in same PDB: d1e60a2, d1e60c2
   complexed with 2mo, pgd, so4

Details for d1e60c1

PDB Entry: 1e60, 2 Å

PDB Description: oxidized dmso reductase exposed to hepes - structure ii buffer

PDB Compounds: (C:) dmso reductase

SCOPe Domain Sequences for d1e60c1:

Sequence; same for both SEQRES and ATOM records:

>d1e60c1 b.52.2.2 (C:626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]}
erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd
vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt
sklaqgncgqtvlaevekytgpavtltgfvapkaae

Timeline for d1e60c1:

• d1e60c1 first appeared (with stable ids) in SCOP 1.55
  
• d1e60c1 appears in SCOPe 2.05
  
• d1e60c1 appears in SCOPe 2.07
  
• d1e60c1 appears in the current release, SCOPe 2.08