Lineage for d1e60c1 (1e60 C:626-781)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802680Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2802689Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)
  7. 2802690Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries)
  8. 2802701Domain d1e60c1: 1e60 C:626-781 [26911]
    Other proteins in same PDB: d1e60a2, d1e60c2
    complexed with 2mo, pgd, so4

Details for d1e60c1

PDB Entry: 1e60 (more details), 2 Å

PDB Description: oxidized dmso reductase exposed to hepes - structure ii buffer
PDB Compounds: (C:) Dimethyl sulfoxide/trimethylamine N-oxide reductase

SCOPe Domain Sequences for d1e60c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e60c1 b.52.2.2 (C:626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]}
erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd
vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt
sklaqgncgqtvlaevekytgpavtltgfvapkaae

SCOPe Domain Coordinates for d1e60c1:

Click to download the PDB-style file with coordinates for d1e60c1.
(The format of our PDB-style files is described here.)

Timeline for d1e60c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e60c2