Lineage for d4wxza_ (4wxz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079861Species Geobacillus kaustophilus [TaxId:235909] [269096] (3 PDB entries)
  8. 2079874Domain d4wxza_: 4wxz A: [269109]
    automated match to d3fema_

Details for d4wxza_

PDB Entry: 4wxz (more details), 2.7 Å

PDB Description: pdxs (g. stearothermophilus) co-crystallized with r5p
PDB Compounds: (A:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d4wxza_:

Sequence, based on SEQRES records: (download)

>d4wxza_ c.1.2.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
kggvimdvvnaeqakiaeaagavavmalervpadiraaggvarmadptvieevmnavsip
vmaxvrighyvearvlealgvdyidesevltpadeefhidkrqftvpfvcgcrdlgeaar
riaegasmlrtxgepgtgniveavrhmrkvnaqirkvvnmsedelvaeakqlgapvevlr
eikrlgrlpvvnfaaggvttpadaalmmhlgadgvfvgsgifksenpekyaraiveatth
yedyeliahlskg

Sequence, based on observed residues (ATOM records): (download)

>d4wxza_ c.1.2.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
kggvimdvvnaeqakiaeaagavavmalergvarmadptvieevmnavsipvmaxvrigh
yvearvlealgvdyidesevltpadeefhidkrqftvpfvcgcrdlgeaarriaegasml
rtxgepgtgniveavrhmrkvnaqirkvvnmsedelvaeakqlgapvevlreikrlgrlp
vvnfaaggvttpadaalmmhlgadgvfvgsgifksenpekyaraiveatthyedyeliah
lskg

SCOPe Domain Coordinates for d4wxza_:

Click to download the PDB-style file with coordinates for d4wxza_.
(The format of our PDB-style files is described here.)

Timeline for d4wxza_: