Lineage for d1e60a1 (1e60 A:626-781)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798408Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1798462Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1798493Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 1798502Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)
  7. 1798503Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries)
  8. 1798512Domain d1e60a1: 1e60 A:626-781 [26910]
    Other proteins in same PDB: d1e60a2, d1e60c2
    complexed with 2mo, pgd, so4

Details for d1e60a1

PDB Entry: 1e60 (more details), 2 Å

PDB Description: oxidized dmso reductase exposed to hepes - structure ii buffer
PDB Compounds: (A:) dmso reductase

SCOPe Domain Sequences for d1e60a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e60a1 b.52.2.2 (A:626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]}
erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd
vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt
sklaqgncgqtvlaevekytgpavtltgfvapkaae

SCOPe Domain Coordinates for d1e60a1:

Click to download the PDB-style file with coordinates for d1e60a1.
(The format of our PDB-style files is described here.)

Timeline for d1e60a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e60a2