Lineage for d4wxyc_ (4wxy C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1816492Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 1816493Protein automated matches [190292] (26 species)
    not a true protein
  7. 1816559Species Geobacillus kaustophilus [TaxId:235909] [269096] (3 PDB entries)
  8. 1816573Domain d4wxyc_: 4wxy C: [269098]
    Other proteins in same PDB: d4wxyb_, d4wxyd_, d4wxyf_, d4wxyh_, d4wxyj_, d4wxyl_
    automated match to d3fema_
    mutant

Details for d4wxyc_

PDB Entry: 4wxy (more details), 2.7 Å

PDB Description: plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p.
PDB Compounds: (C:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d4wxyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxyc_ c.1.2.0 (C:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
maltgtdrvkrgmaemqkggvimdvvnaeqakiaeaagavavmalervpadiraaggvar
madptvieevmnavsipvmaxvrighyvearvlealgvdyidesevltpadeefhidkrq
ftvpfvcgcrdlgeaarriaegasmlrtkgepgtgniveavrhmrkvnaqirkvvnmsed
elvaeakqlgapvevlreikrlgrlpvvnfaaggvttpadaalmmhlgadgvfvgsgifk
senpekyaraiveatthyedyeliahlskglggamrgidiatllpehrmq

SCOPe Domain Coordinates for d4wxyc_:

Click to download the PDB-style file with coordinates for d4wxyc_.
(The format of our PDB-style files is described here.)

Timeline for d4wxyc_: