SCOPe 2.05: Domain d4wq4c2: 4wq4 C:108-229

Lineage for d4wq4c2 (4wq4 C:108-229)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [269076] (3 PDB entries)

8. Domain d4wq4c2: 4wq4 C:108-229 [269078]
   automated match to d2gema2
   complexed with act, atp, fe, gol, peg

Details for d4wq4c2

PDB Entry: 4wq4, 2.33 Å

PDB Description: e. coli ygjd(e12a)-yeaz heterodimer in complex with atp

PDB Compounds: (C:) tRNA threonylcarbamoyladenosine biosynthesis protein tsab

SCOPe Domain Sequences for d4wq4c2:

Sequence; same for both SEQRES and ATOM records:

>d4wq4c2 c.55.1.0 (C:108-229) automated matches {Escherichia coli [TaxId: 83333]}
atrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgw
qawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrnnvawkkl
pg

Timeline for d4wq4c2:

• d4wq4c2 is new in SCOPe 2.05-stable
  
• d4wq4c2 appears in SCOPe 2.06
  
• d4wq4c2 appears in the current release, SCOPe 2.08