SCOPe 2.05: Domain d4wm7c_: 4wm7 C:

Lineage for d4wm7c_ (4wm7 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (10 species)
   not a true protein

7. Species Enterovirus d68 [TaxId:42789] [269068] (5 PDB entries)

8. Domain d4wm7c_: 4wm7 C: [269070]
   automated match to d3vbhc_
   complexed with w11

Details for d4wm7c_

PDB Entry: 4wm7, 2.32 Å

PDB Description: crystal structure of human enterovirus d68 in complex with pleconaril

PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d4wm7c_:

Sequence; same for both SEQRES and ATOM records:

>d4wm7c_ b.121.4.0 (C:) automated matches {Enterovirus d68 [TaxId: 42789]}
gvptyllpgsgqflttddhssapvlpcfnptpemhipgqirnmlemiqvesmmeinntdg
angmerlrvdisvqadldqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
gsfmatgklilcytppggscpttretamlgthivwdfglqssitliipwisgshyrmfns
dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqsnhlh
gaeaayq

Timeline for d4wm7c_:

• d4wm7c_ is new in SCOPe 2.05-stable
  
• d4wm7c_ appears in SCOPe 2.06
  
• d4wm7c_ appears in the current release, SCOPe 2.08