SCOPe 2.06: Domain d4whsc_: 4whs C:

Lineage for d4whsc_ (4whs C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
   alpha and beta chains are derived from a single-chain protomer and share this fold

7. Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)

8. Domain d4whsc_: 4whs C: [269061]
   Other proteins in same PDB: d4whsb_, d4whsd_, d4whsf_
   automated match to d3pcca_
   complexed with 3n8, bme, cl, fe, muc, so4

Details for d4whsc_

PDB Entry: 4whs, 1.35 Å

PDB Description: 4-fluorocatechol bound to protocatechuate 3,4-dioxygenase (pseudomonas putida) at ph 8.5

PDB Compounds: (C:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d4whsc_:

Sequence; same for both SEQRES and ATOM records:

>d4whsc_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

Timeline for d4whsc_:

• d4whsc_ first appeared in SCOPe 2.05
  
• d4whsc_ appears in SCOPe 2.07
  
• d4whsc_ appears in the current release, SCOPe 2.08