Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries) |
Domain d4whpd_: 4whp D: [269051] Other proteins in same PDB: d4whpa_, d4whpc_, d4whpe_ automated match to d3pccm_ complexed with bct, bme, fe, so4 |
PDB Entry: 4whp (more details), 1.54 Å
SCOPe Domain Sequences for d4whpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4whpd_ b.3.6.1 (D:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]} paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
Timeline for d4whpd_: