Lineage for d4whqc_ (4whq C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2379686Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2379709Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2379717Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 2379830Domain d4whqc_: 4whq C: [269050]
    Other proteins in same PDB: d4whqb_, d4whqd_, d4whqf_
    automated match to d3pcca_
    complexed with 3n8, 3n9, bct, bme, cl, fe, gol, na, so4

Details for d4whqc_

PDB Entry: 4whq (more details), 1.78 Å

PDB Description: alkylperoxo reaction intermediate trapped in protocatechuate 3,4- dioxygenase (pseudomonas putida) at ph 6.5
PDB Compounds: (C:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d4whqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4whqc_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d4whqc_:

Click to download the PDB-style file with coordinates for d4whqc_.
(The format of our PDB-style files is described here.)

Timeline for d4whqc_: