Lineage for d4whqb_ (4whq B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1773641Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1773642Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1773851Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 1773866Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 1773915Domain d4whqb_: 4whq B: [269046]
    Other proteins in same PDB: d4whqa_, d4whqc_, d4whqe_
    automated match to d3pccm_
    complexed with 3n8, 3n9, bct, bme, cl, fe, gol, na, so4

Details for d4whqb_

PDB Entry: 4whq (more details), 1.78 Å

PDB Description: alkylperoxo reaction intermediate trapped in protocatechuate 3,4- dioxygenase (pseudomonas putida) at ph 6.5
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d4whqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4whqb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d4whqb_:

Click to download the PDB-style file with coordinates for d4whqb_.
(The format of our PDB-style files is described here.)

Timeline for d4whqb_: