Lineage for d1dmr_1 (1dmr 626-781)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61730Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 61744Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 61750Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins)
  6. 61759Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)
  7. 61760Species Rhodobacter capsulatus [TaxId:1061] [50699] (9 PDB entries)
  8. 61761Domain d1dmr_1: 1dmr 626-781 [26904]
    Other proteins in same PDB: d1dmr_2

Details for d1dmr_1

PDB Entry: 1dmr (more details), 1.82 Å

PDB Description: oxidized dmso reductase from rhodobacter capsulatus

SCOP Domain Sequences for d1dmr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmr_1 b.52.2.2 (626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd
vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt
sklaqgncgqtvlaevekytgpavtltgfvapkaae

SCOP Domain Coordinates for d1dmr_1:

Click to download the PDB-style file with coordinates for d1dmr_1.
(The format of our PDB-style files is described here.)

Timeline for d1dmr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dmr_2