![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
![]() | Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
![]() | Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [50698] (1 PDB entry) |
![]() | Domain d1eu1a1: 1eu1 A:626-780 [26903] Other proteins in same PDB: d1eu1a2 complexed with 6mo, cd, epe, glc, mgd, o, so4 |
PDB Entry: 1eu1 (more details), 1.3 Å
SCOPe Domain Sequences for d1eu1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eu1a1 b.52.2.2 (A:626-780) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]} erlggagakyplhvvashpksrlhsqlngtslrdlyavaghepclinpadaaargiadgd vlrvfndrgqilvgakvsdavmpgaiqiyeggwydpldpseegtldkygdvnvlsldvgt sklaqgncgqtiladvekyagapvtvtvfdtpkga
Timeline for d1eu1a1: