Lineage for d1eu1a1 (1eu1 A:626-780)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412166Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2412197Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2412206Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)
  7. 2412222Species Rhodobacter sphaeroides [TaxId:1063] [50698] (1 PDB entry)
  8. 2412223Domain d1eu1a1: 1eu1 A:626-780 [26903]
    Other proteins in same PDB: d1eu1a2
    complexed with 6mo, cd, epe, glc, mgd, o, so4

Details for d1eu1a1

PDB Entry: 1eu1 (more details), 1.3 Å

PDB Description: the crystal structure of rhodobacter sphaeroides dimethylsulfoxide reductase reveals two distinct molybdenum coordination environments.
PDB Compounds: (A:) dimethyl sulfoxide reductase

SCOPe Domain Sequences for d1eu1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu1a1 b.52.2.2 (A:626-780) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]}
erlggagakyplhvvashpksrlhsqlngtslrdlyavaghepclinpadaaargiadgd
vlrvfndrgqilvgakvsdavmpgaiqiyeggwydpldpseegtldkygdvnvlsldvgt
sklaqgncgqtiladvekyagapvtvtvfdtpkga

SCOPe Domain Coordinates for d1eu1a1:

Click to download the PDB-style file with coordinates for d1eu1a1.
(The format of our PDB-style files is described here.)

Timeline for d1eu1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eu1a2