Lineage for d1eu1a1 (1eu1 A:626-780)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 16157Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 16163Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins)
  6. 16172Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)
  7. 16186Species Rhodobacter sphaeroides [TaxId:1063] [50698] (1 PDB entry)
  8. 16187Domain d1eu1a1: 1eu1 A:626-780 [26903]
    Other proteins in same PDB: d1eu1a2

Details for d1eu1a1

PDB Entry: 1eu1 (more details), 1.3 Å

PDB Description: the crystal structure of rhodobacter sphaeroides dimethylsulfoxide reductase reveals two distinct molybdenum coordination environments.

SCOP Domain Sequences for d1eu1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu1a1 b.52.2.2 (A:626-780) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides}
erlggagakyplhvvashpksrlhsqlngtslrdlyavaghepclinpadaaargiadgd
vlrvfndrgqilvgakvsdavmpgaiqiyeggwydpldpseegtldkygdvnvlsldvgt
sklaqgncgqtiladvekyagapvtvtvfdtpkga

SCOP Domain Coordinates for d1eu1a1:

Click to download the PDB-style file with coordinates for d1eu1a1.
(The format of our PDB-style files is described here.)

Timeline for d1eu1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eu1a2