SCOP 1.55: Domain d1eu1a1: 1eu1 A:626-780

Lineage for d1eu1a1 (1eu1 A:626-780)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins)

6. Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50698] (1 PDB entry)

8. Domain d1eu1a1: 1eu1 A:626-780 [26903]
   Other proteins in same PDB: d1eu1a2

Details for d1eu1a1

PDB Entry: 1eu1, 1.3 Å

PDB Description: the crystal structure of rhodobacter sphaeroides dimethylsulfoxide reductase reveals two distinct molybdenum coordination environments.

SCOP Domain Sequences for d1eu1a1:

Sequence; same for both SEQRES and ATOM records:

>d1eu1a1 b.52.2.2 (A:626-780) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides}
erlggagakyplhvvashpksrlhsqlngtslrdlyavaghepclinpadaaargiadgd
vlrvfndrgqilvgakvsdavmpgaiqiyeggwydpldpseegtldkygdvnvlsldvgt
sklaqgncgqtiladvekyagapvtvtvfdtpkga

Timeline for d1eu1a1:

• d1eu1a1 appears in SCOP 1.57
  
• d1eu1a1 appears in the current release, SCOPe 2.08