![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) |
![]() | Domain d4utam1: 4uta M:0-107 [269026] Other proteins in same PDB: d4utaa1, d4utaa2, d4utaa3, d4utab1, d4utab2, d4utab3, d4utal2, d4utam2 automated match to d1dn0a1 |
PDB Entry: 4uta (more details), 3 Å
SCOPe Domain Sequences for d4utam1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4utam1 b.1.1.1 (M:0-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} seivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgvp arfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkvei
Timeline for d4utam1: