SCOPe 2.05: Domain d4utal2: 4uta L:108-214

Lineage for d4utal2 (4uta L:108-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)

8. Domain d4utal2: 4uta L:108-214 [269024]
   Other proteins in same PDB: d4utaa1, d4utaa2, d4utab1, d4utab2, d4utal1, d4utam1
   automated match to d1dn0a2

Details for d4utal2

PDB Entry: 4uta, 3 Å

PDB Description: crystal structure of dengue 2 virus envelope glycoprotein in complex with the fab fragment of the broadly neutralizing human antibody ede1 c8

PDB Compounds: (L:) broadly neutralizing human antibody ede1 c8 light chain

SCOPe Domain Sequences for d4utal2:

Sequence; same for both SEQRES and ATOM records:

>d4utal2 b.1.1.2 (L:108-214) automated matches {Homo sapiens [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4utal2:

• d4utal2 is new in SCOPe 2.05-stable
  
• d4utal2 appears in SCOPe 2.06
  
• d4utal2 appears in the current release, SCOPe 2.08