SCOPe 2.06: Domain d4utal1: 4uta L:0-107

Lineage for d4utal1 (4uta L:0-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d4utal1: 4uta L:0-107 [269023]
   Other proteins in same PDB: d4utaa1, d4utaa2, d4utaa3, d4utab1, d4utab2, d4utab3, d4utal2, d4utam2
   automated match to d1dn0a1

Details for d4utal1

PDB Entry: 4uta, 3 Å

PDB Description: crystal structure of dengue 2 virus envelope glycoprotein in complex with the fab fragment of the broadly neutralizing human antibody ede1 c8

PDB Compounds: (L:) broadly neutralizing human antibody ede1 c8 light chain

SCOPe Domain Sequences for d4utal1:

Sequence; same for both SEQRES and ATOM records:

>d4utal1 b.1.1.1 (L:0-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgvp
arfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkvei

Timeline for d4utal1:

• d4utal1 first appeared in SCOPe 2.05
  
• d4utal1 appears in SCOPe 2.07
  
• d4utal1 appears in the current release, SCOPe 2.08