SCOPe 2.06: Domain d1aw8.2: 1aw8 D:,E:

Lineage for d1aw8.2 (1aw8 D:,E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)

6. Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
   autocatalytic enzyme

7. Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)

8. Domain d1aw8.2: 1aw8 D:,E: [26902]
   mature enzyme

Details for d1aw8.2

PDB Entry: 1aw8, 2.2 Å

PDB Description: pyruvoyl dependent aspartate decarboxylase

PDB Compounds: (D:) l-aspartate-alpha-decarboxylase, (E:) l-aspartate-alpha-decarboxylase

SCOPe Domain Sequences for d1aw8.2:

Sequence; same for both SEQRES and ATOM records:

>g1aw8.2 b.52.2.1 (D:,E:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
mirtmlqgklhrvkvthadlhyegXxcaidqdfldaagileneaidiwnvtngkrfstya
iaaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk

Timeline for d1aw8.2:

• d1aw8.2 first appeared (with stable ids) in SCOP 1.55
  
• d1aw8.2 appears in SCOPe 2.05
  
• d1aw8.2 appears in SCOPe 2.07
  
• d1aw8.2 appears in the current release, SCOPe 2.08