Lineage for d4wajb_ (4waj B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490902Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2490967Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2490968Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 2491000Protein automated matches [190278] (5 species)
    not a true protein
  7. 2491004Species Haemophilus influenzae [TaxId:71421] [269018] (1 PDB entry)
  8. 2491005Domain d4wajb_: 4waj B: [269019]
    automated match to d2a8da_
    complexed with so4, zn

Details for d4wajb_

PDB Entry: 4waj (more details), 2.7 Å

PDB Description: h. influenzae beta-carbonic anhydase variant p48s/a49p
PDB Compounds: (B:) Carbonic anhydrase 2

SCOPe Domain Sequences for d4wajb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wajb_ c.53.2.1 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
mdkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvspekltnlepgel
fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
ydvndgflvdqgvmatsretleisyrnaiarlsil

SCOPe Domain Coordinates for d4wajb_:

Click to download the PDB-style file with coordinates for d4wajb_.
(The format of our PDB-style files is described here.)

Timeline for d4wajb_: