SCOPe 2.06: Domain d4v3ua_: 4v3u A:

Lineage for d4v3ua_ (4v3u A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein automated matches [190421] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187302] (35 PDB entries)

8. Domain d4v3ua_: 4v3u A: [269012]
   automated match to d4d1na_
   complexed with eg8, gol, h4b, hem, zn; mutant

Details for d4v3ua_

PDB Entry: 4v3u, 2.3 Å

PDB Description: structure of human nnos r354a g357d mutant heme domain in complex with n-2-(2-(1h-imidazol-1-yl)pyrimidin-4-yl)ethyl- 3-(pyridin-3-yl)propan-1-amine

PDB Compounds: (A:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d4v3ua_:

Sequence; same for both SEQRES and ATOM records:

>d4v3ua_ d.174.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Timeline for d4v3ua_:

• d4v3ua_ first appeared in SCOPe 2.05
  
• d4v3ua_ appears in SCOPe 2.07
  
• d4v3ua_ appears in the current release, SCOPe 2.08