SCOP 1.75: Domain d1aw8.1: 1aw8 A:,B:

Lineage for d1aw8.1 (1aw8 A:,B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (1 protein)

6. Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
   autocatalytic enzyme

7. Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)

8. Domain d1aw8.1: 1aw8 A:,B: [26901]
   mature enzyme

Details for d1aw8.1

PDB Entry: 1aw8, 2.2 Å

PDB Description: pyruvoyl dependent aspartate decarboxylase

PDB Compounds: (A:) l-aspartate-alpha-decarboxylase, (B:) l-aspartate-alpha-decarboxylase

SCOP Domain Sequences for d1aw8.1:

Sequence; same for both SEQRES and ATOM records:

>g1aw8.1 b.52.2.1 (A:,B:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
mirtmlqgklhrvkvthadlhyegXscaidqdfldaagileneaidiwnvtngkrfstya
iaaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk

Timeline for d1aw8.1:

• d1aw8.1 first appeared (with stable ids) in SCOP 1.55
  
• d1aw8.1 appears in SCOP 1.73
  
• d1aw8.1 appears in SCOPe 2.01
  
• d1aw8.1 appears in the current release, SCOPe 2.08