SCOPe 2.06: Domain d4v2la_: 4v2l A:

Lineage for d4v2la_ (4v2l A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (10 PDB entries)

8. Domain d4v2la_: 4v2l A: [269007]
   automated match to d4aj8a_
   complexed with act, gol, so4

Details for d4v2la_

PDB Entry: 4v2l, 1.65 Å

PDB Description: Crystallographic structure of thioredoxin from Litopenaeus vannamei: Radiation damage effect at 3.4 MGy, focused in disulfide bonds.

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d4v2la_:

Sequence; same for both SEQRES and ATOM records:

>d4v2la_ c.47.1.1 (A:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk

Timeline for d4v2la_:

• d4v2la_ first appeared in SCOPe 2.05
  
• d4v2la_ appears in SCOPe 2.07
  
• d4v2la_ appears in the current release, SCOPe 2.08