| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein automated matches [190442] (13 species) not a true protein |
| Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (10 PDB entries) |
| Domain d4v2mb_: 4v2m B: [269000] automated match to d4aj8a_ complexed with act, gol, so4 |
PDB Entry: 4v2m (more details), 1.84 Å
SCOPe Domain Sequences for d4v2mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v2mb_ c.47.1.1 (B:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk
Timeline for d4v2mb_: