Lineage for d4ut7l1 (4ut7 L:1-108)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355667Domain d4ut7l1: 4ut7 L:1-108 [268998]
    Other proteins in same PDB: d4ut7l2
    automated match to d2ybrb_

Details for d4ut7l1

PDB Entry: 4ut7 (more details), 1.7 Å

PDB Description: crystal structure of the scfv fragment of the broadly neutralizing human antibody ede2 a11
PDB Compounds: (L:) broadly neutralizing human antibody ede2 a11

SCOPe Domain Sequences for d4ut7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ut7l1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqpvsvsgspgqsitisctgtssnadtynlvswyqqrpgkapklmiyegtkrpsgv
snrfsasksataasltisglqpedeadyyccsyatsrtlvfgggtkltvva

SCOPe Domain Coordinates for d4ut7l1:

Click to download the PDB-style file with coordinates for d4ut7l1.
(The format of our PDB-style files is described here.)

Timeline for d4ut7l1: