Lineage for d4v03b_ (4v03 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2113934Species Aquifex aeolicus [TaxId:63363] [268991] (2 PDB entries)
  8. 2113936Domain d4v03b_: 4v03 B: [268996]
    automated match to d1hyqa_
    complexed with adp, mg

Details for d4v03b_

PDB Entry: 4v03 (more details), 1.9 Å

PDB Description: MinD cell division protein, Aquifex aeolicus
PDB Compounds: (B:) site-determining protein

SCOPe Domain Sequences for d4v03b_:

Sequence, based on SEQRES records: (download)

>d4v03b_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
aevivitsgkggvgkttltanigtalaklgkkvllidadiglrnldmilglenrivydil
dvlegrvpyekalvkdkrglslwllpanqrankdvidiekwnktveeiknsgnydyilvd
spagiekgfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemv
krgamlsvedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmg
esiplk

Sequence, based on observed residues (ATOM records): (download)

>d4v03b_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
aevivitsgkggvgkttltanigtalaklgkkvllidadrnldmilglenrivydildvl
egrvpyekalvkdkrglslwllpavidiekwnktveeiknsgnydyilvdspagiekgfq
iavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemvkrgamlsved
ivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmgesiplk

SCOPe Domain Coordinates for d4v03b_:

Click to download the PDB-style file with coordinates for d4v03b_.
(The format of our PDB-style files is described here.)

Timeline for d4v03b_: